PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0608s0150.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 603aa    MW: 65478.2 Da    PI: 9.0889
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0608s0150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.31.3e-23235279145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  SapurV1A.0608s0150.1.p 235 DQEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 279
                             689***************************************985 PP

2QLQ57.83.3e-20164200137
                     QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                             ++FT++Q+++L++Q+l+yKy+ a++PvP++L+ +++k
  SapurV1A.0608s0150.1.p 164 GPFTPSQWMELEHQALIYKYITARVPVPSNLIIPLKK 200
                             59******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.3E-12164200IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-14165198IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.49165200IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.796235279IPR014977WRC domain
PfamPF088793.6E-20237278IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MDFGVLGLEG LVGPESITDT PSLVSLPETK PKILGSVLTK QERSSSSASA QDDYWRTSKI  60
QKFDDLSATK TMPLHHPTPL LRSNSMLSND SRQQEHMLSF SSPKPEATPF FVRDAVLVER  120
NTQNQTALSF PYYHHGPLSA SRSAGYGTGN LNASMHGAFT GVRGPFTPSQ WMELEHQALI  180
YKYITARVPV PSNLIIPLKK SLNLYGLPGS SAGSFPPSSL GWGTFHLGYP GNNTDQEPGR  240
CRRTDGKKWR CSRDAVADQK YCERHINRGR HRSRKPVEGQ TGHAATGTAS SKVVSMSNSI  300
STSVTTSGAA SNSIVITQQQ LKKLLPGAAS RSSAVARVNG AQDAQRVSMM SSTINRRSDE  360
PTFCIPKQDI LIEQCSQTEF GLVSYDSLLN PSQKSSYISS KPYESFLNFS DEESHDQHPL  420
RQFIDDWPKD QSNRSVISWP EELKPDCTLL SMSIPMASSG FSSPSSSPMR EKLALSPLRL  480
SREIHPMQTG LRVSDEHNES SQKQANWIPI SWGTSIGGPL GEVLTTSTSH VDSCKSSPAL  540
NLSREGWDGS LQVGSSPTGV LQKSTFRSLS NSSSGSSPRA GSKKKNESAG LYEDMAGSII  600
VS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2826941e-155GU282694.1 Populus balsamifera isolate HAY07 haplotype A unknown protein gene, partial sequence.
GenBankGU2826951e-155GU282695.1 Populus balsamifera isolate HAY07 haplotype B unknown protein gene, partial sequence.
GenBankGU2826961e-155GU282696.1 Populus balsamifera isolate MGR10 haplotype A unknown protein gene, partial sequence.
GenBankGU2826971e-155GU282697.1 Populus balsamifera isolate MGR10 haplotype B unknown protein gene, partial sequence.
GenBankGU2826981e-155GU282698.1 Populus balsamifera isolate NWL07 haplotype A unknown protein gene, partial sequence.
GenBankGU2826991e-155GU282699.1 Populus balsamifera isolate NWL07 haplotype B unknown protein gene, partial sequence.
GenBankGU2827001e-155GU282700.1 Populus balsamifera isolate STL13 haplotype A unknown protein gene, partial sequence.
GenBankGU2827011e-155GU282701.1 Populus balsamifera isolate STL13 haplotype B unknown protein gene, partial sequence.
GenBankGU2827021e-155GU282702.1 Populus balsamifera isolate INU03 haplotype A unknown protein gene, partial sequence.
GenBankGU2827031e-155GU282703.1 Populus balsamifera isolate INU03 haplotype B unknown protein gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310328.20.0hypothetical protein POPTR_0007s14720g
TrEMBLB9HFY60.0B9HFY6_POPTR; Uncharacterized protein
STRINGPOPTR_0007s14720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-94growth-regulating factor 1